PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC05G20610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GATA
Protein Properties Length: 383aa    MW: 39117.1 Da    PI: 6.6169
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC05G20610.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.39.1e-18252286135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  OPUNC05G20610.1 252 CLHCETDKTPQWRTGPMGPKTLCNACGVRYKSGRL 286
                      99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.3E-18246296IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.479246282IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.106.4E-15247283IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.52E-15248309No hitNo description
CDDcd002026.90E-14251298No hitNo description
PROSITE patternPS003440252277IPR000679Zinc finger, GATA-type
PfamPF003201.4E-15252286IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MEVAADYAGG VRVKKEAAGG GGGGDMFLVD DLLDLPCDDE EETGLCGAYG AGVGVGAGVV  60
GGGGDDRAAG NASADSSTVT AVDSCSNSFS GLADGDFSGG LCEPYEQLAE LEWVSTYMGE  120
ETLPTEDLRK LQLISGIPAA PRAPPALAVS AVQLPAGGAG ALPTEAPVPG KARSKRSRVA  180
PCSWSSRLMV LPPPPASPPS PASAVISPSE SGTAAPAFPA KKAAKSAKKK DGPTPAPAPN  240
AAAQAAAEGR RCLHCETDKT PQWRTGPMGP KTLCNACGVR YKSGRLVPEY RPAASPTFVV  300
SKHSNSHRKV VELRRQKEMQ LLHQQQPQPQ PHLGTGGGAA AGGLLHVPSP LLFDGPTSSA  360
PLVAGADEFL IHNRIGPDFR QLI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8376640.0CT837664.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA206K19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638019.10.0PREDICTED: GATA transcription factor 12
TrEMBLA0A0E0L4R80.0A0A0E0L4R8_ORYPU; Uncharacterized protein
STRINGBGIOSGA020209-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os05g44400.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30253178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.12e-65GATA transcription factor 12